PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43475.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 354aa    MW: 40405.2 Da    PI: 5.7511
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43475.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.83.8e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWTteEde+l +++   G g+W++ ++  g+ R++k+c++rw +yl
       KHN43475.1 14 KGRWTTEEDEILTKYIMANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding48.42.1e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE+  ++++++ +G+  W++Ia++++ gRt++++k++w+++l
       KHN43475.1  67 RGNFSVEEESTILKLHASFGSS-WSLIASHLP-GRTDNEIKNYWNSHL 112
                      89******************99.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-21564IPR009057Homeodomain-like
PROSITE profilePS5129414.911961IPR017930Myb domain
SuperFamilySSF466893.82E-2711108IPR009057Homeodomain-like
SMARTSM007172.3E-111363IPR001005SANT/Myb domain
PfamPF002499.0E-141461IPR001005SANT/Myb domain
CDDcd001671.03E-71661No hitNo description
PROSITE profilePS5129423.76962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2465116IPR009057Homeodomain-like
SMARTSM007171.7E-1566114IPR001005SANT/Myb domain
PfamPF002491.8E-1467112IPR001005SANT/Myb domain
CDDcd001679.26E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MVRAPCCEKV GLKKGRWTTE EDEILTKYIM ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNF SVEEESTILK LHASFGSSWS LIASHLPGRT DNEIKNYWNS HLSRKIYTFH  120
GKTTSKGIIT LPPRRKRGRT SRWAMKNKNQ KGSSSTQQQQ QQIHHHLNNE VAVPLPPKPP  180
LETEKYLSTN IILMEEQVDG SSTASTITND HKHENTTTMC VEGEKEEILN DDIWGPYVEE  240
VINGGELVLN FDDFMDHCWQ EASGVWTISD EQRESNINIV VGNEKVDDDM CTNVIMSSGD  300
HDRLHSSSSI ASDLDQNLLT WLWEDEDWEK DLQSLGEIHS DKLKAMVDWF LSSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-211211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0942952e-57BT094295.1 Soybean clone JCVI-FLGm-18O14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003553664.10.0PREDICTED: myb-related protein P-like
TrEMBLA0A0B2SEJ60.0A0A0B2SEJ6_GLYSO; Transcription factor MYB12
TrEMBLK7MZK10.0K7MZK1_SOYBN; Uncharacterized protein
STRINGGLYMA19G40250.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.13e-70myb domain protein 12
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]